PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_59162.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 304aa    MW: 33364.9 Da    PI: 8.7812
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_59162.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.61.8e-5191331128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   lppGfrFhPtdeelv++yL+++++g ++ +  +i+e+d+yk++Pw+Lpk++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v +   
  MLOC_59162.1   9 LPPGFRFHPTDEELVMHYLCRRCAGAPIAV-PIITEIDLYKFDPWQLPKMAMYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGT--P 102
                   79**************************99.88***************7666789*************************************99..7 PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +   +kk Lvfy g+apkgekt+W+mheyrl
  MLOC_59162.1 103 KPLAIKKALVFYAGKAPKGEKTNWIMHEYRL 133
                   789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.01E-615159IPR003441NAC domain
PROSITE profilePS5100559.6219159IPR003441NAC domain
PfamPF023652.3E-2610133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MSGGQELNLP PGFRFHPTDE ELVMHYLCRR CAGAPIAVPI ITEIDLYKFD PWQLPKMAMY  60
GEKEWYFFSP RDRKYPNGSR PNRAAGSGYW KATGADKPVG TPKPLAIKKA LVFYAGKAPK  120
GEKTNWIMHE YRLADVDRSA RKKNSLRLDD WVLCRIYNKK GGMEKPASVD RKPVTMGGYG  180
VGPGAMASSP QEQKPVMGMN ANGGGSGGVQ PFPDFAAYYD RPSDSMPRLH ADSSCSEQVL  240
SPDFPGERGG GEVQSQPKIS EWERSFASGG DPVNPAAGSI LEPHGGFGGD PLLQDILMYW  300
GKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-80616512174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3628920.0AK362892.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2010O18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564785.11e-168PREDICTED: NAC domain-containing protein 48
SwissprotQ7F2L31e-165NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLM0XDQ50.0M0XDQ5_HORVD; Uncharacterized protein
STRINGMLOC_59162.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-117NAC family protein